SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000427 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000427
Domain Number 1 Region: 212-392
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-73
Family SPRY domain 0.0000044
Further Details:      
 
Domain Number 2 Region: 71-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000187
Family C1 set domains (antibody constant domain-like) 0.038
Further Details:      
 
Domain Number 3 Region: 3-60
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000193
Family V set domains (antibody variable domain-like) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000427   Gene: ENSDORG00000000452   Transcript: ENSDORT00000000452
Sequence length 443
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_1734:49481:54342:1 gene:ENSDORG00000000452 transcript:ENSDORT00000000452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQVREQMLEYQGRVTLVKDNITTGHAAVRIHGVRASDDGEYRCFFRENESYEEAIVHLKV
AALGSDPHISMEVQDSGQVQLECTSVGWYPEPQVQWRTPTGETLSSRSVSKNPDEEGLFT
VVASVIIGSNSIENVSCSIQNLLLGQEKEARISIPAPFFPRLTPWIVSVAVVLIVLGLLT
IGSIFFIWRLYKERERTSKFSSTEKLLEELKWKKATLHAVDVTLDPDTAHPHLFLYEDSK
SVRLEDSRQNLPDKPERFDSWPCVLGRETFTSGSHYWEVEVGDRTDWAIGVCRENVIKKG
SDPMTPENGFWAVELYGNRYWALTALRTPLPLAGSPRRVGIFLDYESGDISFYNMTDGSQ
IYTFPSTSFSGPLRPFFCLWSCGEKPLTICPVANRPEGVIVVANSQDLSKDIPLSPVGED
SASGDTDTLHSKLIPSQSNQGLP
Download sequence
Identical sequences ENSDORP00000000427 ENSDORP00000000427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]