SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000430 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000430
Domain Number 1 Region: 156-315
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.94e-38
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00036
Further Details:      
 
Domain Number 2 Region: 379-476
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.98e-34
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00048
Further Details:      
 
Domain Number 3 Region: 75-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000287
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 22-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000603
Family EGF-type module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000430   Gene: ENSDORG00000000456   Transcript: ENSDORT00000000456
Sequence length 479
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4744:707:285475:-1 gene:ENSDORG00000000456 transcript:ENSDORT00000000456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSIVARLLLGLSLGIPQGKANICDPNPCENGGICLSDLADDSFSCECPDGFTDPNCSS
IVEVASDEEDPTSAGPCSPNPCHNGGTCEISEAYRGDTFIGYVCKCPHGFNGIHCQHXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSGPLGIEGGIISNQQITASSTHR
AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINLQRKMRVTGVITQGAKRIGSPE
YIKSYKIAYSNDGKTWAMYKVKGTSEDMVFRGNVDNNTPYANSFTPPIKAQYVRLYPQVC
RRHCTLRMELLGCELSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTV
YQDEKQRKDKVLQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Download sequence
Identical sequences ENSDORP00000000430 ENSDORP00000000430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]