SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000434 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000434
Domain Number 1 Region: 52-315
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.94e-47
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000499
Further Details:      
 
Domain Number 2 Region: 400-520
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.38e-28
Family Ricin B-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000434   Gene: ENSDORG00000000458   Transcript: ENSDORT00000000460
Sequence length 523
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1646:7:50030:1 gene:ENSDORG00000000458 transcript:ENSDORT00000000460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEPKEPEPHGVVGGPGEEAKPLVLGPEFKQAIQASIKEFGFNMVASDMISLDRSVNDLRQ
EECKYWHYDDNLLTSSVVIVFHNEGWSTLMRTVHSVIKRTPRKYLAEIVLIDDFSNKDHL
KKKLDDYIKQWNGLVKVYRNERREGLIQARSIGAQKAKLGQVLIYLDAHCEVAVNWYAPL
VAPISKDRTICTVPLIDVINGNTYEIIPQGGGDEDGYARGAWDWSMLWKRVPLTSREKRL
RKTKTEPYRSPAMAGGLFAIEREFFFELGLYDPGLQIWGGENFEISYKIWQCGGKLLFVP
CSRVGHIYRLEGWQGNPPPLYVGSSPTLKNYVXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRGFETSYCIDSMGRTNG
GFVELGPCHRMGGNQLFRINEANQLMQYDQCLTKGPDGSKVMITHCNLNEFKEWQYLKTL
HRFTHVPSGKCLDRSEVLHQVFISSCDSSKRTQKWEMNNIHSI
Download sequence
Identical sequences ENSDORP00000000434 ENSDORP00000000434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]