SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000437 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000437
Domain Number 1 Region: 335-531
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-70
Family Hemopexin-like domain 0.00000746
Further Details:      
 
Domain Number 2 Region: 118-290
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.54e-33
Family Matrix metalloproteases, catalytic domain 0.00000253
Further Details:      
 
Domain Number 3 Region: 28-105
Classification Level Classification E-value
Superfamily PGBD-like 7.53e-21
Family MMP N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000437   Gene: ENSDORG00000000461   Transcript: ENSDORT00000000463
Sequence length 606
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4211:117186:251119:-1 gene:ENSDORG00000000461 transcript:ENSDORT00000000463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILFTLSTGRRLDFLHHSGVFLQSLLWILCATVCGTEQYFNVEVWLQKYGYLPPTEPRMS
VLRSAETMQSALSAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYA
LTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELKNGKRD
VDITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDLF
LVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTR
PLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFK
DQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQP
GYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWK
GIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRDKE
GHSPPDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKR
SMQEWV
Download sequence
Identical sequences ENSDORP00000000437 ENSDORP00000000437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]