SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000448 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000448
Domain Number 1 Region: 74-135
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000514
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 22-86
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000862
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 168-193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000681
Family Complement control module/SCR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000448   Gene: ENSDORG00000000478   Transcript: ENSDORT00000000478
Sequence length 257
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5879:75687:89758:1 gene:ENSDORG00000000478 transcript:ENSDORT00000000478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCRIGSCLMIMWLISASGEMSCPEFPPVDNSIFIAKEEEGQIWGTYLCTEGYHMVGQET
FWCNNSKVWDAFTPECRLGHCPDPVLANGEFNSSGLVNVRDKVTFKCNEHYILKGSNWSE
CLGDHTWGPPLPICKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRLVGPRELRCL
EGEWSGEVPTCEPIPEAPKPAQQIALEKALQAFQEREDLCSAIKNFLKRLKECGLPVDEL
KYSLEIKKAELKAKIQQ
Download sequence
Identical sequences ENSDORP00000000448 ENSDORP00000000448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]