SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000459 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000459
Domain Number 1 Region: 477-675
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-36
Family YWTD domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 43-297
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-30
Family YWTD domain 0.0000876
Further Details:      
 
Domain Number 3 Region: 964-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000657
Family EGF-type module 0.00036
Further Details:      
 
Domain Number 4 Region: 827-934
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 735-777
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000795
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 6 Region: 349-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.021
Further Details:      
 
Domain Number 7 Region: 436-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000433
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000459   Gene: ENSDORG00000000490   Transcript: ENSDORT00000000490
Sequence length 1114
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1643:64706:129255:1 gene:ENSDORG00000000490 transcript:ENSDORT00000000490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSLSLLLPVVVPCSFVTVSAQQHWNCPAEGKGTSTCMGSAPFLIFSHGNGIFRIDPGT
NHKQLVVDAGTSVIMDFHYQKERLYWVDLERHLLQRVGSRQEVVCHIEKNVSGMAINWIN
EELIWFSQQEGIIRVTDMEGNNSRVLVNTSHYPADIAVDPVKRFIFWSSEAAGTLHRADL
GCVEVKTLLQTPGKITTLSLDVLEKRIFWIQRKREGSSSHIWSCDYDGGSIHLLTQQTRH
HLLAMSLFGDRIFYSTLKRETIWIANKHTGKDMVRMNFNASIEAPTELQVVHPFVQPSMD
GGARDSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNECALWSHGC
TLGCENIPGSYYCTCPAGFVLLPDGKRCHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXCSSPDNGGCSQLCIPLSPRSWECGCFPGYNLQLDQRSCTASGPPPVLLF
ANSQDIRRMHFDGTDYGTLLSQQVGTVFALDYDPVENKLYFAHTALKWIERARMDGSQRE
RLIQEGIDMPEGLAVDWIGRRIYWTDRGKSVIEGSDLSGKHRQPIIKENISQPRGIAVHP
VAKRLFWTDTGINPKIESSSLKGSGRLVIASSDLLEPSGLTIDYLTDLLYWCDAKRAVIE
MSNLDGSKRQRLAQNDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXPLAKPGADPCLHQNGGCQQICQESFGTAQCSCHEGFTKAPDGRMCLDPKSHR
PAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSDGDDCGPGGCSRHATCA
SEGENATCRCLQGFAGDGKACFDIDECMLGTAACPPTSSTCINTEGSYVCRCSEGFRGDG
IHCLDVDECQLGVHGCGENADCMNTEGGYTCQCAGLISQPGLPCPDSTSPSPLEEDGRHL
VRNSYPGCPPSHDGYCLHGGVCMYVEAVDSYACNCVVGYIGERCQHRDLRWELRNASHGQ
QRDVTVVAICVVVLVLLLVVGLWEARQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXFVVIEEHQDFGNRIQSTVAEKGQTAE
Download sequence
Identical sequences ENSDORP00000000459 ENSDORP00000000459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]