SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000470 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000470
Domain Number 1 Region: 51-106
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-18
Family Fibronectin type II module 0.0031
Further Details:      
 
Domain Number 2 Region: 19-62
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000542
Family Fibronectin type II module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000470   Gene: ENSDORG00000000504   Transcript: ENSDORT00000000504
Sequence length 106
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_35018:6574:9972:1 gene:ENSDORG00000000504 transcript:ENSDORT00000000504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYLPTIDSEIKFPEIEDGECVFPFWYRKEKYYDCVKLNAKHKWCSLNTTFSGYWKYCAMS
DFAPCAFPFWYRRLIYRKCTEDGEVFGRKWCSLTPDYNRDQVWKYC
Download sequence
Identical sequences ENSDORP00000000470 ENSDORP00000000470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]