SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000523 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000523
Domain Number 1 Region: 13-304
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.27e-49
Family GDI-like N domain 0.0000000036
Further Details:      
 
Domain Number 2 Region: 338-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.05e-16
Family GDI-like N domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000523   Gene: ENSDORG00000000562   Transcript: ENSDORT00000000561
Sequence length 394
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1561:146503:173223:-1 gene:ENSDORG00000000562 transcript:ENSDORT00000000561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYKRFKLPGVPPASMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYMDFKVIEGSFVY
KGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGVDPKKTSMRDV
YKKFDLGQDVIDFTGHSLALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGL
GELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVVGVKSEGEIARCKQLICDPSYVKDRV
EKVGQVIRVICVLSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIA
IVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTDSQIFISRAYDATTHFE
TTCDDIKDIYKRMTGSEFDFEEMKRKKNDIYGED
Download sequence
Identical sequences ENSDORP00000000523 ENSDORP00000000523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]