SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000528 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000528
Domain Number 1 Region: 106-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.44e-54
Family Lectin leg-like 0.0000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000528   Gene: ENSDORG00000000567   Transcript: ENSDORT00000000568
Sequence length 303
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5163:1071:7188:-1 gene:ENSDORG00000000567 transcript:ENSDORT00000000568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERWFWRWGWGQRCPGRPGLPGPGPGPATLVHFLLLLGSVAAXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCFLKDWEMHVHFKV
HGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAVFLDTYPNDETTERVFPYVSVM
VNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDRNEWKNCI
DLTGVRLPTGYYFGASAGTGDLSDNHDIISIKLFQLMVEHTPDEENIDWTKIEPGVNFLK
SPK
Download sequence
Identical sequences ENSDORP00000000528 ENSDORP00000000528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]