SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000530 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000530
Domain Number 1 Region: 270-456
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.31e-37
Family Reprolysin-like 0.00082
Further Details:      
 
Domain Number 2 Region: 546-601
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000157
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 825-884
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000128
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 4 Region: 888-944
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number 5 Region: 944-1002
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000458
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 1003-1036
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000530   Gene: ENSDORG00000000568   Transcript: ENSDORT00000000570
Sequence length 1103
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3471:5762:31927:-1 gene:ENSDORG00000000568 transcript:ENSDORT00000000570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAYQILRWAVALGLGLTFKFTQAFRSQDEFLSSLQSYEIAFPTRXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXHGLIVADEEEYLIEPLRGAAKGARGPEESGPHVVY
KRSSLRHPHLDTACGVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAKLFQDSSLGSIVNILVTRLILLTEDQPT
LDITHHAGKSLDSFCKWQKSIVNHSGHGNAIPENGMANHDTAVLITRXXXXXXXXXXXXX
XXLAPVGGMCERERSCSINEDIGLATAFTIAHEIGHTFGMNHDGVGNSCGARGQDPAKLM
AAHITMKTNPFVWSSCSRDYITSFLDSGLGLCLNNRPPRQDFVYPTVAPGQAYDADEQCR
FQHGVKSRQCKYGEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYKRVCVPFG
SRPEGVDGAWGPWAPWGDCSRTCGGGVSTSSRHCDSPRPTIGGKYCLWERRRHRSCNTED
CPPGSQDFREMQCSEFDSIPFRGKFYTWKTYRGGGVKACSLTCLAEGFNFYTERAAAVVD
GTPCRPDTVDICVSGECKHVGCDRVLGSDLREDKCRVCGGDGSSCETIEGVFSPALPGAG
YEDVVWIPKGSVHIFLLDLNLSLSYLAVKGDQESLLLEGLPGTPQPHRLPLAGTTFHLRQ
GPDQAQSLEALGPINASLVVMVLARKELPALRYRFNAPIARDTLPPYSWHYAPWTKCSAQ
CAGGSQVQVVECRNQLDRSTVAHHYCSAHSKLPKRQRACNTEPCPPDWVVGNWTRCSRSC
DAGVRSRSVVCQRRVSAVEEKSLDDSACPQPRPPVLEACQGPTCPPEWSALDWSECTPSC
GPGLRHRVVLCKSADHRATLPPAQCPPAAKPPATMRCNLRRCPPARWVASEWGECSAQCG
LGQQQRAVRCTGHTGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKDVNKVAYCPL
VLKFQFCSRAYFRQMCCKTCQGR
Download sequence
Identical sequences ENSDORP00000000530 ENSDORP00000000530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]