SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000582 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000582
Domain Number 1 Region: 49-205
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.17e-27
Family Dual specificity phosphatase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000582   Gene: ENSDORG00000000626   Transcript: ENSDORT00000000625
Sequence length 230
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1816:160483:193525:-1 gene:ENSDORG00000000626 transcript:ENSDORT00000000625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGPHHDRCCIYNENNVVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHHAMHYSRIV
PNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIVQNSSGCNRYPEPMSPDTMMKLY
KEEGLAYVWMPTADMSTEGRVQMLPQAVCLLHALLENGHNVYVHCNAGVGRSTAAVCGWL
HYVLGWKLRKIQYFLMAKRPAVFIDEDALSRAQEDFFQKFGKICSLRCTR
Download sequence
Identical sequences ENSDORP00000000582 ENSDORP00000000582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]