SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000609 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000609
Domain Number 1 Region: 18-91
Classification Level Classification E-value
Superfamily RING/U-box 3.12e-22
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 2 Region: 439-511
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-22
Family SPRY domain 0.00018
Further Details:      
 
Domain Number 3 Region: 101-161
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.12e-17
Family B-box zinc-binding domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000609   Gene: ENSDORG00000000653   Transcript: ENSDORT00000000654
Sequence length 515
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_13643:15778:27240:1 gene:ENSDORG00000000653 transcript:ENSDORT00000000654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDL
ERDFPCPVCRKTSRYRSLRPNRQLGSMVEIAKQLQAVKRKIRDEILCSQHHEALSLFCYE
DQEAVCLICAISHTHRAHTVVPLDDATQEYKEKLQKCLEPLEYKLQEITRCKSSEEKKPG
ELKRLVENRRQQILKEFEELHRRLDEEQQILLSRLEEEEQDILQQLRENAAHLGDKRRDL
AHLAAEVEDKCFQSGFEMLKDVKSTLEKNAPKKFGSFSTNCLGYHIALYRTEESNCEKVK
TMAVTSVSIELKKNFSHFPRQYFALRKILKQLIXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTF
TDTFTEKLWPLFYPGIRAGRKNAAPLTIRPPTDWE
Download sequence
Identical sequences ENSDORP00000000609 ENSDORP00000000609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]