SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000618 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000618
Domain Number 1 Region: 348-497,524-570
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.6e-40
Family Extended AAA-ATPase domain 0.0000172
Further Details:      
 
Domain Number 2 Region: 129-198
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-16
Family Ankyrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000618   Gene: ENSDORG00000000660   Transcript: ENSDORT00000000663
Sequence length 684
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4493:2005:129472:-1 gene:ENSDORG00000000660 transcript:ENSDORT00000000663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASQLLRRTAPAPRLLLRLVRSSSLQSLGGASRRSVTTGDCGEPQWPRASAGGRPLTLS
ALLPGLGAPPSGPLGGRSETQCLAAATWGRLPIPEEILTGQDSWNGVPCRAAVGLWALAM
ALVVDCYTKNPNSKDAALMEAARANNVPEVTRLLSEGADVNARHKLGWTALMVAAISRND
SVVQVLLAAGADPNLGDDFSSVYKTAKEQGIHSLEXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANPVQRNEMGH
TPMDYAREGEVMKLLKTSESKYMEKQRKREAEERRRFPLEIRRKENGWYDEEHPLVFLFL
GSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYIGHEEGGQLT
KKLKQCPNAVVLFDEVDKAHPDVLTIMLQLFDEGRLTDGKGKTIDCKDAIFIMTSNVASE
EIAQHALQLRQEALELSRNRIAENLGDVQMSDKITISKNFKENVIRPILKAHFRRDEFLG
RINEIVYFLPFCHSELIQLVNKELNFWAKRQQHITLLWDXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXEKVCHTI
Download sequence
Identical sequences ENSDORP00000000618 ENSDORP00000000618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]