SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000625 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000000625
Domain Number - Region: 80-121
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0497
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000625   Gene: ENSDORG00000000672   Transcript: ENSDORT00000000670
Sequence length 506
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_207:312268:357570:-1 gene:ENSDORG00000000672 transcript:ENSDORT00000000670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREKIHSLRRDHKPSKEEESDLLEPGDEEVEAAFGLTTGGRVGKGCQTCHEMVSNHQHQL
QPVAGTNPKAVRHNCPAHYLVHQCILKGVVRRLSSLICTHRMGQKGNHRNTPLHLAVMLG
NKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXPLLSRILPSDACKIYKQGINIRLDTTLIDFTDMKCQRG
DLSFIFNGDAAPSESFVVLDNEQKVYQRIHHEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXERVGNFLADFYLVNGLVLESRKRREHLSEEDILRNKAIMESLSK
GGNIMEQNFEXXXXXXXXXXXXXXXXXXXXXXXXXXXAPHLGRELVCKESKKTFKATIAM
SQEFPLGIELLLNVLEVIAPFKHFNKLREFVQMKLPPGFPVKLDIPVFPTITATVTFQEF
RYDEFDGSIFTIPDDYKEDPSRFPDL
Download sequence
Identical sequences ENSDORP00000000625 ENSDORP00000000625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]