SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000683 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000683
Domain Number 1 Region: 132-243
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-30
Family C-type lectin domain 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000683   Gene: ENSDORG00000000732   Transcript: ENSDORT00000000732
Sequence length 243
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_15832:4294:7924:1 gene:ENSDORG00000000732 transcript:ENSDORT00000000732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPFPSALLLLSVMQATNPETIVNEDAQKTCPAIACCPGLNGFPGKDGRDGAKGEKGDPG
EGLRGIQGPPGKVGPPGPPGLRGISGPMGPKGDPGKKGECDSRMVDSKVTSLRSELELIK
KWLYFSLVKKVGKKVFLSSGEKMSFDKVKALCASVQASVATPRNDKENRAIRSTTSELAF
LGITDEVHEGQFVDMTGAPLHYTNWNEHEPNNADPGEDCVILLSDGKWNDIPCSRSYMAV
CEF
Download sequence
Identical sequences ENSDORP00000000683 ENSDORP00000000683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]