SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000760 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000760
Domain Number 1 Region: 262-360
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.2e-26
Family Leukotriene A4 hydrolase catalytic domain 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000760
Domain Number - Region: 227-255
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 0.000484
Family Leukotriene A4 hydrolase N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000760   Gene: ENSDORG00000000810   Transcript: ENSDORT00000000811
Sequence length 941
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4066:104998:146677:-1 gene:ENSDORG00000000810 transcript:ENSDORT00000000811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSLSFKWPLTSVSLSCLLSWLLTLLAVCTRAWCQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKSVTIAEGLIEDHFDV
TVKMSTYLVAFIISDFKSVSKMTKSGVKVSVYTVPDKINQADYALDAAVTLLEFYEDYFS
IPYPLPKQDLAAIPDFASGAMENWGLTTYRESSLLFDAEKSSASSKLGITMTVSHELAHQ
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHWHQGTDVKTMMNTWTLQKFPLITITVRGV
HMKQEHYMKGSDSTPETGYLWHVPLTFITSKSDSVQRFLLKTETDVLILPEAVEWIKFNV
GMNGYYIVHYEDNGWDSLAGLLKGTHTAIGSNDRASLINNAFQLVSIGKLSIEKALDLTL
YLKYETEIMPVFQGLNELIPMYKLMEKRDMNEVEMQFKAFLLRLLRDLIDKQIWADEGSV
SERMLRSQLLLLACVRKYQPCVHRAEGYFRKWKESNGNMSLPVDVTLAVFAVGAQNTEGW
DFLYNKYQSSLSSTEKSQIEFALCTSQNREKLQWLLDESFKGDVIKTQEFPHILTLIGRN
SVGYPLAWQFLRENWNELVQKFELGSSSLAHMVLGTTNQFSTRTRLEEVKEFFSSLKENG
SQLRCVQQTVETIEENIRWMDKNFDKIRVWLQSEKLEHPDG
Download sequence
Identical sequences ENSDORP00000000760 ENSDORP00000000760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]