SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000778 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000778
Domain Number 1 Region: 141-373
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.42e-71
Family Eukaryotic proteases 0.001
Further Details:      
 
Domain Number 2 Region: 3-39
Classification Level Classification E-value
Superfamily SEA domain 0.000000863
Family SEA domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000778   Gene: ENSDORG00000000830   Transcript: ENSDORT00000000830
Sequence length 374
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4094:6584:29949:-1 gene:ENSDORG00000000830 transcript:ENSDORT00000000830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKACFYRSSFQILNVEYTDELSSPATQEYRTLSEQIESMXXXXXXXXXXXXXXXXXXXXX
XXQSGSGVTADVVMKFRFSKRNDGNSMKGRVQAILQKMLNNSGGLEIHSSPGITTITSQD
TENIFTQACGARPDLLTLSEERIIGGTLAEDGDWPWQVSLHVNNVHHCGGILISNTWILT
AAHCFRSYSNPQQWTATFGASTIFPKRRARIRTIVVHNNYRSGTQENDIAVVQLNTAITF
TKDIHSVXXXXXXXXXXXXXXXXXXXXXXXXXXXFTVSDLRQGQVRIISNTVCNAPTAYN
GAVLSGMLCAGVPTGGVDACQGDSGGPLVQEDSRRLWFVVGIVSWGYQCGLPDKPGVYTR
VATYRNWIREQTRV
Download sequence
Identical sequences ENSDORP00000000778 ENSDORP00000000778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]