SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000783 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000000783
Domain Number - Region: 34-58,87-117
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00565
Family Ankyrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000783   Gene: ENSDORG00000000833   Transcript: ENSDORT00000000835
Sequence length 188
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5842:516:5651:-1 gene:ENSDORG00000000833 transcript:ENSDORT00000000835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKQPELVSKKLQIFQKMDKEPQIRAESLGLEYHAAVVAGDLDRVRHLMEQFFRDANMVF
EISKDEMKWQVEFPAASGLSGLWTLERRRELTTPLYISAPGGHAACEQLLDPGADPDASX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAEDLRPGPRHHGSFQLLCSALC
VVMEGADP
Download sequence
Identical sequences ENSDORP00000000783 ENSDORP00000000783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]