SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000786 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000786
Domain Number 1 Region: 51-178
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-28
Family C-type lectin domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000786   Gene: ENSDORG00000000839   Transcript: ENSDORT00000000838
Sequence length 179
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_901:12091:22886:-1 gene:ENSDORG00000000839 transcript:ENSDORT00000000838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWHMIISMLIVVLVIGMTLFLLHFGRRKCVIPMGSGAVSQIFGNNNNGLIPTRSYGTAC
PKDWDLHQGRCFFFSIGEEHWSRSKEDCVTKDSTLAIVNTPEKLTYLQEIAGVEKYFIGL
IRGAGTTEKRWHWIDNSEFNGNVTHQNQNFNCVTIGLTKTFDAAPCDVSYRWICEKTPG
Download sequence
Identical sequences ENSDORP00000000786 ENSDORP00000000786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]