SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000825 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000825
Domain Number 1 Region: 150-413
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.54e-100
Family PDEase 0.0000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000825   Gene: ENSDORG00000000875   Transcript: ENSDORT00000000878
Sequence length 540
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1948:5728:150986:-1 gene:ENSDORG00000000875 transcript:ENSDORT00000000878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSTATIELADTTYYLIGAQTENVRLKDVLRCLVKQLERGDVNIVDLKKNIEYAASVLEA
VYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRSIVHAV
QAGIFVEXXXXXXXXXXXXXXXXXXXXXXXDVDKWSFDVFALNEASGEHSLKFMIYELFT
RYDLIXXXXIPVSCLIAFAEALEVGYSKYRNPYHNLIHAADVTQTVHYVMLHTGIMHWLT
ELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLMQEEEM
NIFANLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRSSLQQPEGIDRAKTMSLILHAA
DISHPAKTWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPDLHKSTEDSVNAEEKQADTHP
Download sequence
Identical sequences ENSDORP00000000825 ENSDORP00000000825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]