SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000831 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000831
Domain Number 1 Region: 494-654
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.02e-44
Family MAM domain 0.00051
Further Details:      
 
Domain Number 2 Region: 157-318
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-30
Family MAM domain 0.0021
Further Details:      
 
Domain Number 3 Region: 328-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-27
Family MAM domain 0.0015
Further Details:      
 
Domain Number 4 Region: 23-142
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000038
Family MAM domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000831   Gene: ENSDORG00000000884   Transcript: ENSDORT00000000884
Sequence length 676
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6625:177647:314857:1 gene:ENSDORG00000000884 transcript:ENSDORT00000000884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRSVLLMVQALQLSLALDLSAGSCAFEDGTCGFDSVMEFLPWILNEEGHYVYVDTSFA
KPGEKAVLLSSDLQAEEWSCLRLVYQIAASSGALSDSSQLSLHVRFEDETFDRLLWSTKE
PSDSWLIVSLDLQDSPKKFKLVGLGNSSMPLEIMTGYCIECDFEENHLCGFVNRWNPNVN
WFVGGGTTRNTHSNLPKDHTFKSELGHYMYVDSVYVKHFQEVAQLVSPVTTAPMSGCLSF
YYQLEQRNDNVFSLYTRDVAGLYEEIWKVNNPGNAAWNLAEVEFSAPYPIEVIFEVAFNG
PKGGYVALDDISFSPVHCQNQTLPFSAVEASCNFEEDFCKFYQDKEGLGWTRVKVKPNMY
RAGDHTTGFGYYLLANTKFTSQPGYIGRLYGPSLPGNLQYCLRFHYAISGFLKMSDTLAV
YIFEENHMVQEKIWSVLESPRGVWIQAEISFKKPMPTKVVFMSLCKSFWDCGLVALDDIM
IQLGSCRSPERLPPPPGECTFDQDECAFTQEKRNPSSWHRRRGETPTSYTGPKGDHTTGV
GYYMYIEASHMVYGQKAQLSSRPLRGVPGKHCLIFFYHMYGAGTGLLSVYLKKEKESDTS
LLWRRRGEQSISWLRALVEYSCTRQYQIIFEAIRGVSIRSDIAIDDIKFQPGPCAEMEDT
PQQSSGYSEDLNEIEY
Download sequence
Identical sequences ENSDORP00000000831 ENSDORP00000000831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]