SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000871 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000871
Domain Number 1 Region: 4861-5076
Classification Level Classification E-value
Superfamily GFP-like 1.67e-62
Family Domain G2 of nidogen-1 0.00066
Further Details:      
 
Domain Number 2 Region: 2469-2568
Classification Level Classification E-value
Superfamily Immunoglobulin 2.49e-25
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 3234-3334
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-24
Family I set domains 0.0056
Further Details:      
 
Domain Number 4 Region: 2388-2476
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-23
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 3610-3709
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-23
Family I set domains 0.0082
Further Details:      
 
Domain Number 6 Region: 4068-4165
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-23
Family I set domains 0.017
Further Details:      
 
Domain Number 7 Region: 3058-3145
Classification Level Classification E-value
Superfamily Immunoglobulin 2.37e-23
Family I set domains 0.0084
Further Details:      
 
Domain Number 8 Region: 2576-2664
Classification Level Classification E-value
Superfamily Immunoglobulin 3.41e-23
Family I set domains 0.01
Further Details:      
 
Domain Number 9 Region: 2675-2763
Classification Level Classification E-value
Superfamily Immunoglobulin 5.44e-23
Family I set domains 0.013
Further Details:      
 
Domain Number 10 Region: 1164-1261
Classification Level Classification E-value
Superfamily Immunoglobulin 6.15e-23
Family I set domains 0.0091
Further Details:      
 
Domain Number 11 Region: 2874-2965
Classification Level Classification E-value
Superfamily Immunoglobulin 6.51e-23
Family I set domains 0.0092
Further Details:      
 
Domain Number 12 Region: 3896-3988
Classification Level Classification E-value
Superfamily Immunoglobulin 7.45e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 13 Region: 792-884
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 14 Region: 2784-2866
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-22
Family I set domains 0.02
Further Details:      
 
Domain Number 15 Region: 1744-1828
Classification Level Classification E-value
Superfamily Immunoglobulin 3.32e-22
Family I set domains 0.023
Further Details:      
 
Domain Number 16 Region: 3794-3893
Classification Level Classification E-value
Superfamily Immunoglobulin 5.06e-22
Family I set domains 0.0061
Further Details:      
 
Domain Number 17 Region: 1086-1177
Classification Level Classification E-value
Superfamily Immunoglobulin 5.71e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 18 Region: 3138-3238
Classification Level Classification E-value
Superfamily Immunoglobulin 7.52e-22
Family I set domains 0.0092
Further Details:      
 
Domain Number 19 Region: 3702-3800
Classification Level Classification E-value
Superfamily Immunoglobulin 9.28e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 20 Region: 3980-4074
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-21
Family I set domains 0.039
Further Details:      
 
Domain Number 21 Region: 3435-3521
Classification Level Classification E-value
Superfamily Immunoglobulin 3.61e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 22 Region: 518-618
Classification Level Classification E-value
Superfamily Immunoglobulin 3.61e-21
Family I set domains 0.038
Further Details:      
 
Domain Number 23 Region: 42-217
Classification Level Classification E-value
Superfamily vWA-like 3.95e-21
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 24 Region: 889-983
Classification Level Classification E-value
Superfamily Immunoglobulin 7.29e-21
Family I set domains 0.0095
Further Details:      
 
Domain Number 25 Region: 4338-4428
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-20
Family I set domains 0.0076
Further Details:      
 
Domain Number 26 Region: 1541-1640
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-20
Family I set domains 0.0056
Further Details:      
 
Domain Number 27 Region: 2008-2105
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 28 Region: 3327-3427
Classification Level Classification E-value
Superfamily Immunoglobulin 5.31e-20
Family I set domains 0.009
Further Details:      
 
Domain Number 29 Region: 1635-1734
Classification Level Classification E-value
Superfamily Immunoglobulin 2.62e-19
Family I set domains 0.0056
Further Details:      
 
Domain Number 30 Region: 2190-2288
Classification Level Classification E-value
Superfamily Immunoglobulin 3.28e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 31 Region: 2294-2366
Classification Level Classification E-value
Superfamily Immunoglobulin 3.45e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 32 Region: 2098-2195
Classification Level Classification E-value
Superfamily Immunoglobulin 9.45e-18
Family I set domains 0.0074
Further Details:      
 
Domain Number 33 Region: 981-1074
Classification Level Classification E-value
Superfamily Immunoglobulin 1.88e-17
Family I set domains 0.0093
Further Details:      
 
Domain Number 34 Region: 1270-1320,1499-1548
Classification Level Classification E-value
Superfamily Immunoglobulin 1.73e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 35 Region: 4630-4688
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000017
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 36 Region: 610-664,746-799
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000119
Family I set domains 0.038
Further Details:      
 
Domain Number 37 Region: 4574-4631
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000209
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 38 Region: 4688-4745
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000301
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 39 Region: 4519-4569
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000955
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 40 Region: 4744-4802
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000209
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 41 Region: 4802-4859
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000209
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 42 Region: 2957-3050
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000224
Family I set domains 0.011
Further Details:      
 
Domain Number 43 Region: 4458-4520
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000255
Family I set domains 0.023
Further Details:      
 
Domain Number 44 Region: 5306-5345,5425-5517
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000581
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 45 Region: 4156-4243
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000193
Family I set domains 0.018
Further Details:      
 
Domain Number 46 Region: 5082-5187
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000534
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 47 Region: 4242-4314
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000539
Family I set domains 0.013
Further Details:      
 
Domain Number 48 Region: 427-522
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000703
Family I set domains 0.037
Further Details:      
 
Domain Number 49 Region: 5191-5241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000288
Family EGF-type module 0.02
Further Details:      
 
Domain Number 50 Region: 1876-1908
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000444
Family I set domains 0.027
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000871
Domain Number - Region: 1950-1988
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0114
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000871   Gene: ENSDORG00000000927   Transcript: ENSDORT00000000930
Sequence length 5625
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3524:77601:479610:1 gene:ENSDORG00000000927 transcript:ENSDORT00000000930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISWEMVLQVFLWVLLSSSRAQDASPPWESGAEGIPEGASTLAFVFDVTGSMYDDLVQVI
EGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPE
MSIGAIKIALEISLPGSFIYVFTDARSKDYRLAHEVLQLIQQKQSQVVFVLTGDCDDRNH
IGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLTQAVNTWKIPF
DPSLKEVTVSLSGPSPMIEIRNPLGKLIKKGFGLNELLNIHNSAKVVNVKEPEAGMWTVK
TSSSGRHSVRITGLSTIDFRAGFSGKPTLDFKKTASRPVQGIPTYVLLNTSGISSPARVD
RLELLSISGVSLKTIPVKYYPDRKPYGIWNISDFIPPNEAFFLKITGYDKDDYLFQRVSS
VSFSNIVPAAPTVTMPMKTPGYYLQPGRILCSVESLLPFTLSFVRNGITLGVDQYFKESA
SVNWDIEKVTLSDEGSYECVAVSSAGTGKAQTFFDVSEPPPIIQVLENVTITPGETAVLT
CLVTSAVDYNLTWQRNSRDVRLVEPARIRMLANLSLELRSVKISDAGQYHCTVSNEGGSA
AASVFLTIQEPPKVTVMPKNQSFTGGSEVSIMCSATGYPKPKIAWTMNDLFLVGSHXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXDLELRPSTFLVIDPLLGLLKIQETQDLDAGDYTCIAINDAGR
ATGKITLDVGSPPVFIQEPADVSVEIGSNVTLPCYVQGYPEPKIRWQRLDHMPLFSRPFS
VSSISQLRTGALTILNLWASDKGTYICEAENQFGKIQSQATVTVTGLVAPLIGISPSVAN
VIEGQQLTLPCTLLAGNPIPEHRWIKNSATLVQNPYITVRSDGSLHIERVRLQDGGEYTC
VARNVAGVSNKTTSVVVHVLPTIQHGQQVLSTIEGIPVTLPCKASGIPKPSIVWSKKGEL
ISSGDAKFSAGADGSLYVVSPGGEESGEYVCTATNAAGYAKRKVQLTVYVRPRIFGDQRG
LSQDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTFLPSGSMKITET
RISDSGLYLCVATNIAGNVTQTVKLSVHVPPKIQRGPKYIKIQVGQRVDIPCSTQGSPPP
VITWLKGGRTVLVDGGQRVSNPDGTLSIDQAMLSDAGVYTCAATNIAGRDEADITLHVQE
PPTMEDLAPPFDTPFQERLANERITFPCPVKGTPKPTIKWLRNGRELTGREPGISVLENG
TLFVIASVTPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLFLGDPN
IELVERGQILHLKNTRRSDKGRYQCIVSNAAGKQAKDMKLTVYIPPSIKGGNVTTEISAL
INSVIKLECEAKGLPVPVITWYKDGQLIISNSQALYVDKGQFLHIPQAQVSDSATYTCHV
TNVAGTAEKSFHVDIYVPPIIEGDLATPLNKQVILTQPLTLECKAAGNPAPAITWLKDGV
PVKASDKIRIEAGGKKLEILSALEVDRGQYICVATSVAGEKEIKYEVDVLVPPAVEGGDE
ISYFIVMVNNLLELDCHVTGSPPPTIMWLKDGHLIDETDGFKILLNGRKLVITQAQVSDT
GLYQCVASNMAGNHRKEFEVTVHVPPTIKSSGLSEMTVVKHKPVTXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIQSSGRVLQIAKTLLEDAGRYTCVATNAAGEIQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVITWYKDSRPLSGSTSVAFLRGQLDIEKAQ
ISDAGIYKXXXXXXXXXXXXXXXXXXXXPPSISGSSSMVSVVINNVVRLECEARGIPAPS
LTWLKDGSPVSSFTDGIQVLSGGRILALTSAQVSDTGRYTCVAVNAAGEKQRDIDLRVYV
PPNIMGEEQNISVLISQAVELLCQSDAIPLPTLTWLKDGPLLKKPGLSISENGSVLKIED
AHVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIYDSDKLAQLTVIEGNLISLLCESSGI
PPPNLIWKKGSTVLADSGGRVRILSGGRQLQISVAEKSDVGLYTCVASNAAGTAKKDYNL
QVHIRPSITNSGSQPTEVIVTRGKSISLQCEVQGIPQPTVTWMKDGRPLTKGRGVEIVDR
GRSLQLKNTHVSDTGRYVCIAVNVAXXXXXXXXXXXXPPTIIGDHGVPENISVVEKNSVS
LTCEASGIPLPSITWLKDGWPVSLGSSVRILSGGRMLRLMQARVEDAGQYTCVVRNAAGE
ERKIFGLSVLVPPHIMGENVLEDVKVKEKESVTLTCEVTGNPMPEITWHKDGQLLQQDET
HHIMSGGRLLQISDARVSHTGRYTCLATNAAGDKNKSFSLNVFVSPTIAGVDSNGSPEDV
IVILNSPTSLVCEAYSYPPATITWFKDGAPLESNRNIRILPGGRTLQILNAQEDNAGRYS
CVATNEAGEMMKHYEVKVYIPPIISRGDLLGPGLSPKEVKIKVNNTLTLECEAYAIPLAS
LSWYKDGQPLKSDDHVTIAANGHTLQIKEAQISDTGRYTCVASNLAGEDELDFDVNIQVP
PSFQKLWEIGNMLDTGRTGEAKDVIINNPISLYCETNATPPPTLTWYKDGQPVTSSDRVL
IFPGGRVLQIPRAKAEDAGRYTCVAVNEAGEDSLHYDVRVLLPPVIKGANGDVPEEVTVL
VNHHAQMECSASGSPAPRNVWQKDGLPVLEDEHHKFLSNGRILQILNTQIADTGRYVCIA
QNTAGSTKKYFNLNVHVPPSVVGPPENLTVVVNNFISTCEVSGFPPDLSWLKNEQPIKPN
TNALIVPXXXXXXXXXXXXXDGGEYTCIAINQAGESKKRVSLTVYVPPSIKDQGSEVLSV
VNVREGTSVSLECESNAVPPPVITWYKNGRMITESTHMEILADGQMLHIKKAEVSDTGQY
VCRAINVAGRDDKNFHLNVYVPPSIEGPEREAVVETISNPVTLTCDATGIPPPSIAWLKN
HKPIENSDSLEVHILSGGSKLQIARSQRSDSGNYTCIASNMEGKAQKNYVLLIQVPPSVA
GAEVPSEISVLLGENVELVCNANGIPTPLIQWLRDGKPIVNGETERVRVTASGSTLNING
ALPSDMGKYTCVATNPAGEEDRIFNLNVYVPPKIRGNKEEAEKLMALVDTSINIDCRATG
TPPPQINWLKNGLPLPLSSHVRLLSAGQAIRIVRAQVSDVAVYTCVASNRAGVDTKHYSL
QVIVPPNLDNAMGTEEITIVRGSSTSMTCFTDGTPTPSVSWLRDGQPLGLDAHLTVNTQG
MVLQLIKAETEDSGRYTCIASNDAGEASKHFILKVLEPPHINGSEGSGEVSVIVNYPLEL
SCFASGIPTLNCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAG
DDDKEYLVRVHVPPNIVGTGEPQDVTVVQNRQVTLECKSDAVPPPVIMWLRNGEQLQATP
RVRILSGGRYLQVNNADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKGGPESLVTLL
NKSTVLECLTEGVPVPRVTWRKDGSVLSGDHSRYSILENGFLHIQSAHVADTGRYLCMAT
NVAGTARRRIDLQVHVPPSIAPGPTNITVTVNVQTTLACEATGIPKPSISWRKNGYLLNV
DQNQNSYRLLSSGSLVIISPSVDDTASYKCTVTNDAGEDRRTINLTVQVPPSIADEPTDY
LVTKRAPAVITCTASGVPFPSIHWTKNGVRLLPRGDGYRILSSGTIEISATQLNHAGRYT
CIARNTAGSAHRHVSLHVQEPPVIQPQPSELDVILNNPILLPCEATGIPSPFIGWQKEGI
NVVSSGKNHAVLPSGSLQITRAVREDSGTYMCVAQNPAGTALGKIKLNVQVPPVIRTHPQ
EYIIAIDQPITLPCEADGLPPPDIVWHKDGHTITESIRQRILNSGALQIAFAQLEDAGQY
TCMAANVAGSSSVRAKLTIHVPPSIRNTEIHYAVNENSQAILPCVADGIPTPAIHWEKDN
VPLSNLLGKYTAQPYGELILENVVXXXXGLYTCANVAGEDTHTILTVHVLPTFTELPGDV
SLNKGERLRLSCKATGIPLPKLTWTFNNNIIPAHFDGASGHSELVIEKVSKEDSXXXXXX
XXXXXXXXXXXXXXXXXXPPVFKGDDPSNWIEPLGGNAVLNCEVKGEPAPTIQWSRRGVD
IEISHRIRQLGNGSLAIYGTVNEDAGDYTCVATNDAGAVERSMSLTLQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXPTITWSRQGRSIPWDDRVSVLSNNSLYIVAAQQEDTSEYEC
VARNLMGSVLVRVPVIVQVHGGFSPWSSWRSCSVTCGKGIQKRSRLCNSPPPANGGKRCH
GSDSEARTCQNKLCPVDGHWSEWSLWEECTRSCGRGNRTRTRACNDPPAQHGGRPCEGNA
VEIIMCNARPCPVHGAWSAWQPWGACSESCGKGNQMRTRLCNNPPPSFDGAYCIGPETQV
QACNEKHCPVDGKWTTWTSWSACTVSCGGGARQRTRDCANPVPQYGGRRCEGSDIQSDFC
NSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPHPSNGGRACGGPDTQVQRCNSD
MCPVDGSWGNWQSWSHCSVSCGGGEKTRKRQCDNPVPSKSGRSCTGDATQVSRCNVQACP
GGPQRARGSVIGNINDVEFGIAFLNATIIDSPNFDSRIIHAKITNVPRSLGPAMRKIVSI
LNPIYWTTAKEIGEAVNGFTLTNAIFKRETQVEFATGEILRMTHIARGLDPDGALLLDVV
VSGYVLQLPSPAEVNVKDYTEDYIQTGPGQLYAHSTRLFAIDGISIPYTWNHTIFYDQTR
GRMPFLVETLYASSVESDYNQIEETLGFKLHASISKGDRSNQCPSGFTLDAVGPFCADED
ECTAGNPCSHTCHNAMGTYYCSCPSGLTIAADGRTCQDIDECSLGSHACRTGQDCDNTIG
SYRCVVHCGIGFRRTSDGLSCQDINECQESSPCHQRCFNVIGSFHCGCEPGYQLKGRRCL
DVNECRQNVCRPDQHCKNTRGGYKCIDLCPNGMTKAENGTCIXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXINECEQVPRPCAHQCSNTPGSFQCICPPGQHLLG
DGSCAGLERLPNYGTQYSNYNFVRLSPVRNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVDECQNRDTCQHECKNTIGSYQCTCPPGYQLMLNGKTC
QDIDECLEQNIRCGPNRMCFNMRGSYQCIDTPCPPNYQRDPMTEFCLKNCPPNDLECALS
PYALEYKLISLPFGIAANQDLIRLVAYTQDGVIHPRTTFLMVDEDQTVPFALRDENLKGV
VYTTRPLREPETYRMRVRALSYSANGTLEYQTTFIVYIAVSAYPY
Download sequence
Identical sequences ENSDORP00000000871 ENSDORP00000000871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]