SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000883 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000883
Domain Number 1 Region: 12-119,154-272
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.41e-54
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 250-383
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000435
Family Ankyrin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 461-506
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000196
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000883   Gene: ENSDORG00000000942   Transcript: ENSDORT00000000942
Sequence length 523
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6830:2286:101950:-1 gene:ENSDORG00000000942 transcript:ENSDORT00000000942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVKRMDFTEAYSDTCSTVGLAAREGNVKVLKKLLKKGRCVDVADNRGWMPIHEAAYHNSI
ECLRMLIHAESSETYIQTKTFEGFCALHLAASQGHWKIVQILLEAGADPNATTLEETTPL
FLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNAEIIKLLLKKGANKECQD
DFGITALFVAAQYGKLESLRILISSGANVNCQALDKATPLFIAAQEGHSECVELLLSSGA
DPDLYCNEDNWQLPIHAAAQMGHSKILDLLIPLTNRICDTGPDKVSPVYSAVFGGHERCL
EILLQNGYSPDAQMCLVFGFGSPMCMAFQKDCEFFGIVNILLKYGAQLNELHLASCLKYE
KFSVFRYFIKKGCPLTSWNHISEFISHAVEAQTKYKEWLPHLLLAGFDPLTLLCSSXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVPCLTHLCRLEIRSSLKL
EHLRSDSFIRQLPLPTSLHNYLLYEDVLRRNEVPELATIHDGE
Download sequence
Identical sequences ENSDORP00000000883 ENSDORP00000000883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]