SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000931 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000931
Domain Number 1 Region: 499-762
Classification Level Classification E-value
Superfamily Folate-binding domain 1.73e-78
Family Aminomethyltransferase folate-binding domain 0.000024
Further Details:      
 
Domain Number 2 Region: 47-260,371-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.23e-58
Family FAD-linked reductases, N-terminal domain 0.00029
Further Details:      
 
Domain Number 3 Region: 260-370
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.06e-29
Family L-aminoacid/polyamine oxidase 0.0078
Further Details:      
 
Domain Number 4 Region: 764-850
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 2.94e-22
Family Aminomethyltransferase beta-barrel domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000931   Gene: ENSDORG00000000991   Transcript: ENSDORT00000000992
Sequence length 861
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2791:3851:71509:-1 gene:ENSDORG00000000991 transcript:ENSDORT00000000992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRGAQRLRGLPLPSCPGRLRSVGSPEGKEKLSSSTETKWKDRAETVIIGGGCVGVSLA
YHLAKAGMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYYSIKLYEKLEEETGQ
VVGFHQPGSIRIATTPVRVDEFKYQMTRTGWHATEQYIIEPEQIQEMFPLLNMNKILAGL
YTPGDGHIDPYSLTMALAAGARKYGALLKYPAPVTSLKPRPDGTWDVETLQGSIRANRIV
NAAGFWAREVGKMIGLEHPLIPVQHQYIITSTIPEVKALKQELPVIRDLEGSYYLRQERD
GLLLGPYESQEKMKIQDSWVTSGVPPGFGKELFESDLDRIMEYVEMAMEMVPVLKNADII
NIINGPITYSPDILPMVGPHQGVRNYWVAIGFGYGIIHAGGIGRYLSDWILHGEPSFDLI
ELDPNRYGKWTTTQYTEAKARESYGFNNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXPSFRRTNWFEPVGSEYKQVMQKVGVIDLSPFGKFNIRGP
DSVRLLDHLFANVIPKVGFTNISHMLTPKGRVYAELTVSHQSPGEFLLITGSGSELHDLR
WIEEVAIKGGYDVEIKNITDELGVLGVAGPLARKVLQKLTSEDLSDDVFKFLQTKSLKVS
NIPVTAIRISYTGELGWELYHRREDSEALYDVIMNAGQEEGIDNFGTYALNVLRLEKAFR
AWGSEMNCDTNPFEAGLDYFVKLNKPADFIGKQALKQIKAKGLKRRLVCLTLTTDDVDPE
GNESIWYKGKVVGNTTSGSYSYSIQKSLALAYVPLELSKVGQQVEVELLGKNYPATIIQE
PLVLTEPTRNRLQKNGRKDKA
Download sequence
Identical sequences ENSDORP00000000931 ENSDORP00000000931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]