SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000948 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000000948
Domain Number - Region: 667-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0276
Family Laminin-type module 0.069
Further Details:      
 
Domain Number - Region: 585-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family Laminin-type module 0.028
Further Details:      
 
Domain Number - Region: 363-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000948   Gene: ENSDORG00000001008   Transcript: ENSDORT00000001010
Sequence length 958
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1337:31373:87781:-1 gene:ENSDORG00000001008 transcript:ENSDORT00000001010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STTQDARISSTGLSVPGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEICTVPCAAGTY
GPNCSSVCSCNNDGICSPIDGSCTCKEGWQGLDCSLPCPSGTWGLNCNESCTCAHGASCS
PTDGSCACTPGWLGESCELPCPDGTFGLNCTEHCDCSHADGCDPVTGHCCCLAGWTGIRC
DSTCPQGRWGPNCSISCSCENGGSCSPEDGSCECAPGFRGPLCQRICSPRFYGHGCAQPC
PLCVHSSGPCHHISGVCECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSC
QCFPGWIGKDCSQACPPGFWGSACFHTCSCHNGATCSAEDGTCHCTPGWTGLFCTQRCPA
AFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGRHCEQRCAPGTFGYGCQQLCECMNAT
CDHVTGCCSPXXXXXXXXXXALMMEELNPYTKISPALGTERHSVGAVTGIVLLLFLIVVL
LGLFAWRRRRQKEKGRDLAPRVSYTPAMRMTSTDYSLSGACGMDRRQNTYIMDKGFKDYM
KDSACSSSTCSLNSSENPYATIKDPPILTCKLPESSYVEMKSPMHRGSPYTDGPSLSTSN
KNIYEVEPTISVVQEGLGHNSSYIQNPYDLKNSHIPGHYDLLPVRQSRANGSSRDMQS
Download sequence
Identical sequences ENSDORP00000000948 ENSDORP00000000948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]