SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000986 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000986
Domain Number 1 Region: 7-159
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.81e-45
Family F-box associated region, FBA 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000986   Gene: ENSDORG00000001051   Transcript: ENSDORT00000001049
Sequence length 162
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_64783:3493:6228:-1 gene:ENSDORG00000001051 transcript:ENSDORT00000001049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INIYQPAPPTGPTQQPLEALGNFHGWYIGSEKLQHNLSWTVKQQCVNLLAEGLWEELLDD
EQPDVTVMDWFEDSRLDDCVYELHVWLLAADRRTVIAQHHVAPRTLGRGPPGNWIQVSHV
FRQYGPGVRFVHFLHKTKNRIEPRGLRRTRVTDSSVSVQLRE
Download sequence
Identical sequences ENSDORP00000000986 ENSDORP00000000986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]