SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001006 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001006
Domain Number 1 Region: 68-223
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.05e-44
Family Matrix metalloproteases, catalytic domain 0.0000388
Further Details:      
 
Domain Number 2 Region: 246-359
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.81e-30
Family Hemopexin-like domain 0.0009
Further Details:      
 
Domain Number 3 Region: 1-54
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000000958
Family MMP N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001006   Gene: ENSDORG00000001071   Transcript: ENSDORT00000001071
Sequence length 359
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_3245:82378:88399:-1 gene:ENSDORG00000001071 transcript:ENSDORT00000001071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGYLQKPLEVDDFSPEDIMEALRAFQEASELPVSGQLDEATKARMRQPRCGLEDPFNQKT
LKYLLLGRWRKKHLTFRILNLPSSISSYKARAALLQAFRYWSNVAPLTFREVQAGWADIR
LSFHGRQSPTCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHELG
HALGLGHSRYTQALMAPVYAGYRPYFKLHPDDVAGIQALYGKKTPETEDEEEEMEVPIVS
PVPIEPGPMPNPCSSELDAMMLGPHGKTYAFKGDYVWTVTNTGLGPLFRISALWEGLPGN
LDAAVYSPRTQWIHFFKGKVWRYINFRMAPGFPKKLNRVEPNLDAALYWPLNQKVFLFK
Download sequence
Identical sequences ENSDORP00000001006 ENSDORP00000001006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]