SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001086 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001086
Domain Number 1 Region: 187-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000108
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 148-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000015
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 3 Region: 108-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000383
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 70-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001086   Gene: ENSDORG00000001159   Transcript: ENSDORT00000001159
Sequence length 357
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2417:23071:26743:-1 gene:ENSDORG00000001159 transcript:ENSDORT00000001159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDCSLHCDLGHGCCAPDGSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGHDCERKAGPCEQAGSPCQNGG
QCQDNQGFALNFTCRCLAGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAG
RFCTINLDDCASQPCQRGARCRDRIHDFDCLCPSGYGGKTCELVLPAPGPVTMTDTPRGP
TLAMVVPATGPALHSAGAGLLRISVKEVVRRQEAGLGESSLVALVVFGALTAALVLATVL
LTLRAWRRGICPLEPCCYPVPHYAPARQDQECQVSMIPAGFPLPPDLAPEPGKTTAL
Download sequence
Identical sequences ENSDORP00000001086 ENSDORP00000001086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]