SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001089 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001089
Domain Number 1 Region: 944-1258
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.11e-76
Family Ankyrin repeat 0.00000969
Further Details:      
 
Domain Number 2 Region: 107-484
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.16e-76
Family Ankyrin repeat 0.00000759
Further Details:      
 
Domain Number 3 Region: 515-585
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000117
Family Ankyrin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001089   Gene: ENSDORG00000001160   Transcript: ENSDORT00000001162
Sequence length 2506
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2717:5121:92761:1 gene:ENSDORG00000001160 transcript:ENSDORT00000001162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VESFILDQEDLDNPVLKTTSEIFLSSTAEGADLRTVDPETQARLEALLEAAGIGKLSTAD
GKAFADPEVLRRLTSSVSCALDEAAAALTRMRAENSHNAGQVDTRSLAEACSDGDVNAVR
KLLDEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAASSG
GYLDIVKLLLLHDADVNSQSATGNTALTYACAGGFVDIVKVLLNEANIDHNENGHTSMAS
AHVEVRVLLDHGAXXXXXXXXXXXXXXXXXXXXXHLDMVRFLLEAGADQEHKTDEMHTAL
MEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVND
EGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGA
DIELGCSTPLMEASQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADVLLQ
AGADLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANVNRATANNDHTVVSLACAGGHLA
VVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYLLDYPNNVLSVPTTDVSQLAPPS
QDQSQVPRVPMHTLAMVVPPQEPDRTSQETSSAHLGAQKGTSKQKSSSLQVADQDLLPPF
HPYQPLECIVEETEGKLNELGQRISAIEKAQLKSLELIQGEPLNKDKIEELKKNREEQVQ
KKKKILKELQKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGERDSSLP
EDHFSELPQVDTILFKNNDVDDEQQIPPSAEQIDYVPVQPLSPPQCNFSRDLGSNGTNSL
ELQKVSGNQHIVGQPQIAITGHDQGLLVQEPDGLMVATPAQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTESNHDTALTLACAGGHEE
LVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLA
CSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKL
GISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKAN
VEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCE
LLINRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGADVDAADNRKITPLMSAFRKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXSREESRKQALAAKREKRKEKRKKKKEEQKRKQEDEESKPKENSELPEDED
DENDEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEGEMNPNSLSTSYKSVSLPLSSP
NIKLNLTSPKRGQKREEGWKEVVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXGGTESTRYAVQLINALIQDPAKELEDLIPKNHIRTPASTKSIHAN
FSSGVGTTAASSKNAFPLGAPSLVTSQATTLSTFQPTNKLNKNVPTNVRSSFPVSLPLAY
PHPHFALLAAQTMQQIRHPRLPMAQFGGTFTPSPNTWGPFPVRPVNPGNTSNSPKHNTTT
RLPNQNGTVLSSESPGLGTTSCPITVSSVVAASQQLCVTNTRTPSSVRKQLFACVPKTXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXLPSIDPSGSSPSSSSATLTSFSGIPGTRVFLQGPAPVGTPNFNRQHF
SPHPWTSASNSSTSAPPTLGQPKGGSASQDRKIPPPIGTERLARIRQGGSVAQAPVGTSF
VAPVGHSGIWSFGVNAMSEGLSGWSQSIIGNHPMHQQLSDPSTFSQHQPMERDDSGMVAP
SNIFHQPMASGFVDFSKGLPISMYGGTIIPSHPQLADVPGGPLFNGLHNPDPAWNPMIKV
IQNSAECTDAQQASLLSSVPALKGEIPSPQLTRPKKRVGQPMVASPNQRHQDHLRPKVPA
GVQELTHCPDTPLLSPSDSRGHNXXXXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences ENSDORP00000001089 ENSDORP00000001089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]