SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001096 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001096
Domain Number 1 Region: 1083-1215
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000392
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 2 Region: 884-1014
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000108
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 704-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000111
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 4 Region: 742-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000304
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 404-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000117
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 6 Region: 783-901
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 619-746
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000204
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 208-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000029
Family EGF-type module 0.019
Further Details:      
 
Domain Number 9 Region: 554-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 10 Region: 511-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000107
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 93-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000268
Family EGF-type module 0.016
Further Details:      
 
Domain Number 12 Region: 1955-2011
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000029
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 13 Region: 130-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 14 Region: 12-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000021
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 363-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 16 Region: 170-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000768
Family EGF-type module 0.01
Further Details:      
 
Domain Number 17 Region: 1012-1053
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family EGF-type module 0.029
Further Details:      
 
Domain Number 18 Region: 246-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 19 Region: 56-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000154
Family EGF-type module 0.01
Further Details:      
 
Domain Number 20 Region: 1252-1291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000154
Family EGF-type module 0.013
Further Details:      
 
Domain Number 21 Region: 1211-1255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000154
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 22 Region: 1449-1479
Classification Level Classification E-value
Superfamily Notch domain 0.000000248
Family Notch domain 0.0034
Further Details:      
 
Domain Number 23 Region: 595-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000224
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 24 Region: 286-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000347
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001096
Domain Number - Region: 1064-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0512
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001096   Gene: ENSDORG00000001171   Transcript: ENSDORT00000001171
Sequence length 2131
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2879:5:82581:-1 gene:ENSDORG00000001171 transcript:ENSDORT00000001171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPEGFLGEYCQHRDPCETNRCQNGGTCVAQAMLGKATCRCAPGFTGEDCQHSTSHPCFVS
RPCLNGGTCHMLSRETYECTCQVGFTGKLCQWTDACLSHPCANGSTCTTVANQFSCKCPA
GFTGQKCEADVNECDIPGQCRHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCAN
GGTCRQTGDFTFECNCLPGFEGSTCERNVDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTG
QFCTEDVDECLLQPNACQNGGTCTNSNGGYGCVCVNGWSGDDCSENIDDCAFASCTAGST
CIDRVASFSCMCPEGKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCL
DKIGGFTCLCMPGFGVHCELEINECQSNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXFTGVLCEENVDNCDPDPCHHGQCQDGIDSYTC
LCNPGYMGAICSDQIDECYSSPCLNEGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNP
CVQGSCVDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCMCPEGPH
HPSCYSRVNECLSSPCIHGNCTGGLSGYKCLCDAGWVGTNCEVDRNECLSNPCQNGGTCD
NLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTV
LAPCSPNPCENAAICKEASNFESYTCLCAPGWRGQRCTIDIDECVSKPCMNQGLCHNTQG
SYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLPGFTGEKCQADMNEC
LSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNIDECTESSCFNGGTCIDGISSFSCLC
PVGFTGPFCLHEINECNSHPCLNEGTCVDGLGTYRCTCPLGYTGKNCQTLVSLCSRSPCK
NQGTCIQEKAESRCLCPSGWTGAYCDVPNVPCEVAALRKKVHVDHLCQNSGVCISAGNTH
HCQCPPGYTGSYCEEQLDECASNPCQHGATCSDFTGGYRCECVPGYQGVNCEYEVDECQN
QPCQNGGTCVDLVNHFKCSCPPGTRGLLCEENIDDCAGGPHCLNGGQCVDRIGGYNCLCL
PGFAGERCEGDINECLSSPCNSEGSLDCIQLTNDYQCVCRSAFTGRHCETFMDVCPQMPC
LNGGTCAVARNMPDGFICLCPPGFSGAKCQSSCGQVKCRRGEHCVHTASGPRCFCPNPDC
ESCASNPCQHGGSCRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADRPENLAEGTLVIVVLLPP
EQLLQDSRSFLRALGTLLHTNLRIKRDSQGSLMVYPYYGEKPAALKKQKVARRSLPDEHD
QEVAGSKVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESIPPGH
TQLLYLLAVAIVIILFIILLGVIMAKRKRKHGFLWLPEGFTLRRDSSNHXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEETPLFLAAREGSYEAAKILLDHFAN
RDITDHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGAVLTSALSPVICGPNRAFLSLK
HTPMGKKPRRPNTKSAVPTSLPSLAKGAKGNRRKKSLSEKVQLSESSVTLSPVDSLESPH
TYVSDATSSPTIPSLVLWQSTNPLSIPIPPP
Download sequence
Identical sequences ENSDORP00000001096 ENSDORP00000001096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]