SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001097 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001097
Domain Number 1 Region: 192-433
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.34e-82
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 45-170
Classification Level Classification E-value
Superfamily SEA domain 1.15e-24
Family SEA domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001097   Gene: ENSDORG00000001172   Transcript: ENSDORT00000001172
Sequence length 434
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6465:36397:68332:-1 gene:ENSDORG00000001172 transcript:ENSDORT00000001172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVEILETEYPRVEYQRRQQFWDPIRLALFTLAIAAIIGITIGIVTHFVVEDDKSFYYLAS
FKVTNIKYKETYGIRSSRDFTERSHQIERMMSRIFRRSSGGGRYIKSHVIKLSPDEKGVN
ILLVLMFRYPSTDSVELIKKKIERNLYQSMKIKQLPLTINKPSFTLTPIDSRKMRNLLNS
RCGIRMTSSNMPLPASSSTERIVQGRETAMEGEWPWQASLQLIGAGHQCGATLISNTWLL
TAAHCFRKNKDPSQWIATFGTTITPPAVKRSVGKIIVHENYKRETNENDIALAQLTSRVE
FSNIVQRVCLPDSSMKLPSKTSVFVTGFGSIVDDGPTQNKLRQARVETIGTDVCNRKDVY
DGLITPGMLCAGFMEGKVDACKGDSGGPLVYDNRDVWYIVGIVSWGQSCALPKKPGVYTR
VTKYRDWIASKTGI
Download sequence
Identical sequences ENSDORP00000001097 ENSDORP00000001097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]