SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001105 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001105
Domain Number 1 Region: 540-612,729-941
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.8e-64
Family Protein kinases, catalytic subunit 0.00059
Further Details:      
 
Domain Number 2 Region: 998-1295
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.02e-37
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0063
Further Details:      
 
Domain Number 3 Region: 288-499
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.1e-36
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 
Domain Number 4 Region: 2-96
Classification Level Classification E-value
Superfamily UBC-like 3.16e-24
Family RWD domain 0.00000916
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001105
Domain Number - Region: 1301-1395
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00085
Family Anticodon-binding domain of Class II aaRS 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001105   Gene: ENSDORG00000001179   Transcript: ENSDORT00000001181
Sequence length 1531
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2572:3728:51533:1 gene:ENSDORG00000001179 transcript:ENSDORT00000001181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKGPPEINLVLYPQGLAGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKS
RLEELARKHCGEVMIFELAYHVQSFLSEHNKPPPKSFHEEMLARQAQEERQRLLEAQRRE
EQEQREILHEIQRRKEEIKEEKKRKEMAKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXRDRQYSICGSDDSPGSCEILYFSAGGPDQLMVHKGKCVGS
DEQLGKLVYNALETATGSFVLLYEWVLQWQKKLGPFLTSQEKEKIDKCKKQIQGAETEFS
SLVKLNHPNVVRYFAMSFREQDDCMVVDMLVEHVSGLSLAEHLSHAGPIPVPQLRRFATQ
LLAGLDYLHSNSVVHKVLSTSSVLVDAQGTVKITDYSISKRLADICKDDVFEQTRVRFSD
SALPYKSGKKGDVWRLGLLLLSLSQGQECGEFPVTIPRDLPADFQDFLRKCVCLDDKDRW
TPQQLLKHSFINPQPKMPLVEQSPEDSGGQDYVETVIPSSRLPSASFFSETQRQFSRYFI
EFEELQLLGKGAFGAVIKVQNKLDGCCYAVKRIAINPASRHFRRIKGEVTLLSRLHHENI
VRYYNAWIERHERPPDARPPARNQAADGGAEHGAPAGGLGSVEAAAPPPISSSVEWSTSE
RSPAGPGSSSDEEEEDEHDGVFSQSFLPASDSESDIIFDNEDENSKSQHEDEDNHDKNTH
HGSEPAAATEAVHYLYIQMEYCEKSTLRDTIDQGLYRDTSRLWRLFREILDGLAYIHEKG
MIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFAADGKQDDQAGDHLTKSDPSGHLTGMV
GTALYVSPEVQGSTKSTYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPSSPKF
PEDFEDGEHMKQKSVISWLLNHDPAKRPTATELLRSELLPPPQMEESELHEVLHHTLAHD
GKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKIQQHVCEAVIRIFKRHGAVQL
CTPLLLPRNRQIYEHNEAAVFMDHSGMLVMLPFDLRVPFARYVARNNILNLKRYCIERVF
RPRKLDRFHPKELLECAFDIVTSTTNSSLPTAETIYTIYEIIQEFSALQERNYSIYLNHT
MILKAVLLHCGIPEDKLSQVYVILCDAVTEKLTRREVEAKFCNLSLPSNSLCRLYKFIEQ
KGDLQDVMPMINSLIKQKTGVAALVKYGLKDLEEVIGLLKKFGIKLQVLVNLGLVYKVQQ
HSGIIFQFVAFIRRRQRAVPEILAAGGRYDLLVAVSSCDLLVVSAGQMSMSRAISLTQKL
WAAGITAELMYDWSQSLEELQEYCRHHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLE
SDLVDHVLQKLRTKVSDERNTREASDNLAVQSLKGSFSNASGLFEIHGAPVVPIVSVVAP
EKLSASTRRRYETQVQTRLQTTLANLHQKSSEIEILAVDLPKETILQFLSLEWDGDEQAF
NMTVKQLLSRLPKQRYLKLVCDEIYNIKVEK
Download sequence
Identical sequences ENSDORP00000001105 ENSDORP00000001105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]