SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001144 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001144
Domain Number 1 Region: 8-219,325-382
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.75e-46
Family FAD-linked reductases, N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 222-325
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.22e-25
Family D-aminoacid oxidase-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001144   Gene: ENSDORG00000001222   Transcript: ENSDORT00000001222
Sequence length 390
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1623:150095:166054:1 gene:ENSDORG00000001222 transcript:ENSDORT00000001222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPQKDLWDAIVIGAGIQGCFTAYHLAKHRKRVLLLEQFFLPHSRGSSHGQSRIIRKAYA
EDFYTQMMDDCYQIWAQLQREAGTQLHRPAELLFLGMKENPELKAIQDTLTRHGIEHQYL
SSEELKQHFPNIRLTRGEVGLVDKTGGILYADKALRVLQNAIRQLGGTMCDGEKVVEIRP
GQPAVVKTTSKSYQAKSLIITAGPWTKDLLSPLGIELPLQVLRINVCYWKEKDPGSYSVS
QAFPCFLGLDVAPHHVYGIPSGEYPGLMKVCYHHGNNVAPDERDCPIAFSDIPDIQILRQ
FVRDYLPDLNPEPDIMERCMYTNTPDKHFILDCHPKYDNIVIGAGFSEHGYKLAPVVRKI
LYELSMKLTPAYDLTPFRISRFSGLDKAHL
Download sequence
Identical sequences ENSDORP00000001144 ENSDORP00000001144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]