SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001148 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001148
Domain Number 1 Region: 569-596,638-835
Classification Level Classification E-value
Superfamily vWA-like 4.03e-58
Family Integrin A (or I) domain 0.0003
Further Details:      
 
Domain Number 2 Region: 45-236
Classification Level Classification E-value
Superfamily vWA-like 1.2e-49
Family Integrin A (or I) domain 0.00042
Further Details:      
 
Domain Number 3 Region: 485-605
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000126
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 364-483
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000251
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 5 Region: 282-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000046
Family EGF-type module 0.028
Further Details:      
 
Domain Number 6 Region: 317-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000008
Family EGF-type module 0.021
Further Details:      
 
Domain Number 7 Region: 911-954
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000209
Family Chicken cartilage matrix protein 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001148   Gene: ENSDORG00000001226   Transcript: ENSDORT00000001226
Sequence length 957
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2770:4605:84455:1 gene:ENSDORG00000001226 transcript:ENSDORT00000001226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKMLVSCLLLLLGQLPFFLPTAARERSHSRSLSRGRHTRTHPQTALLESSCENKRADLV
FIIDSSRSVNTYDYAKVKEFIMDILQFLDVGPDVTRVGLLQYGSTVKNEFSLKTFKRKSE
VERAVKRMRHLSTGTMTGLAIQYALNIAFSEAEGARPLRENVPRVIMIVTDGRPQDSVAE
VAAKARDTGILIFAIGVGQVDLNTLKHGSEPHEDHVFLVAFSQIESLTSVFQNKLCXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDLCATEDHACEQLCVNVPGSF
VCQCYSGYTLAEDGKRCVAVDYCALENHGCEHECVNADNSYLCRCRQGFALNPDEKSCTK
IDYCASPGHGCQHECVNTDNSYACRCLKGFTLNPDKKTCRRINYCALNKPGCEHECVNTE
EGYYCRCRRGYTLDPNGKTCSRVDHCAQQDHGCEQLCLNTEDSFVCQCSEGFLINDDLKT
CSRVDYCLLSNHGCEYSCVNTDKSFACQCPEGHVLRSDGKTCAQLDSCALGNHGCEHLCV
SKEDSFVCQCFEGYTLRDDGKSCRRKDVCQAVTHGCEHVCVSSGESYTCKCLEGFRLAED
GKRCRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTEGPIDLVFVID
GSKSLGEENFEIVKQFVTGIIDSLAVSPKAARVGLLQYSTQVRTEFTLRNFSSARDMKKA
VVHMKYMGKGSMTGLALKHMFERSFSQAEGARPLSTRVPRAAIVFTDGRAQDDVSEWASK
AKANGITMYAVGVGKAIEEELQEIASEPTDKHLFYAEDFSTMGEISEKLKQGICEALEDS
DGRQDSPAEEFPQKVHQPTESEPVTINIRDLLSCSNFAVQHRYLFEEDNLPWSTHKRFHS
TKSSGSPLEEKHDQCKCENLIMFQNLANEEVRKLTQRYVLEEMTERMEALENRLRYR
Download sequence
Identical sequences ENSDORP00000001148 ENSDORP00000001148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]