SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001149 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001149
Domain Number 1 Region: 137-257
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000000000204
Family Nuclease 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001149   Gene: ENSDORG00000001227   Transcript: ENSDORT00000001227
Sequence length 257
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3807:13156:19515:1 gene:ENSDORG00000001227 transcript:ENSDORT00000001227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSRHVGKIRKRLEDVKNQWVRPARADFSDNESARLATDALLDGGPEAYGRALSQEGEI
DFLSSVEAQYIQAQAKEPPRAPDPTGGAEAGPRGLDTCSLQSGTYFPAASEGSQPALLHS
WASAQKPYKKEKSSATVYFQTDKHNNIRDLIRRCIARSSQVLAILMDVFTDVEIFCDILE
ASNKRGVFVCVLLDQAGVQLFQEMCDKVQISDRHLKNISIRSVEGEVYCAKSGRKFSGQI
QEKFIISDWRYVLSGSY
Download sequence
Identical sequences ENSDORP00000001149 ENSDORP00000001149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]