SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001175 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001175
Domain Number 1 Region: 259-465
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.39e-37
Family Reprolysin-like 0.0022
Further Details:      
 
Domain Number 2 Region: 551-608
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000017
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 3 Region: 1148-1205
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000536
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 4 Region: 1073-1131
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000876
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 5 Region: 1345-1404
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000102
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 6 Region: 1019-1074
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000562
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 1200-1261
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 8 Region: 1409-1463
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000746
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 9 Region: 1292-1348
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000085
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 10 Region: 1461-1519
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 11 Region: 1580-1640
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 12 Region: 1514-1577
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 13 Region: 1644-1692
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 14 Region: 974-1019
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001175
Domain Number - Region: 843-898
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00017
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001175   Gene: ENSDORG00000001254   Transcript: ENSDORT00000001255
Sequence length 1805
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4658:1326:114673:-1 gene:ENSDORG00000001254 transcript:ENSDORT00000001255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQPKLLETLSEYEIASPIRVNALGEPFPTNVHFKRRRRSINSASDPWPAFASSSSSSSST
SSSRAHYRLSAFGQQFLFNLTAHAGFIAPLFTVTLLGEPAVNQTKFYSQEEAELKHCFYK
GHVNTKSEHTAVISLCSGMLGTFRSYDGDYFIEPLLSMDEQEEEEEQNKPHIIYRHSNPR
RAHGTGRRMCDTSEHRNSHRKDKRKARTRKWGERNDLAEDVAILNHSLTSQAFSAYGNRT
DDVRKTRSHRRTKRFLSYPRFVEVMVVADNKMVSYHGANLQHYILTLMSIVASIYKDPSI
GNLINIVIVNLVVIHNEQEGPSISFNAQTTLKNFCQWQHSKNSSGGIQHDTAVLVTXXXX
XXXXXXXXXXXXXXXXXXXXXXXSCSISEDSGLSTAFTIAHEGHVFNMPHDDNNKCKEEG
VKSPQHVMAPTLNFYTNPWMWSKCSRKYITEFLDTGYGECLLNEPESRPYPLPPQLPGLL
YNVNKQCELIFGPGSQVCPYMMQCRRLWCNNVDGANKGCRTQHTPWADGTECEPGKHCKF
GFCVPKEMDVPPTDGSWGGWSHFGSCSRTCGGGIKTAIRECNRPEPKNGGKYCVGRRMKF
KSCNTEPCPKQKRDFRDEQCAHFDGKHFNINGLLPNVRWVPKYSGILMKDRCKLFCRVAG
NTAYYQLRDRVVDGTPCGQDTNDICVQGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKT
VAGIFNSVHYGYNTVVRIPAGATSIDVRQHSFSGKSEDDNYLALSSSKGEFLLNGDFVVT
MSKREIRVGNAVIEYSGSDNVVERINSTDRIEQELLLQVLSVGKLFNPDVRYSFNIPIDD
KPQQFYWNSHGPWQACSKPCQGERRRRPVCTRESDQLTVSDQRCDRLPQPGPVTEACATD
CDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXCSKSCDGGSQRRRAICVNTRNDVLDDSKCIHQEKVTVQRCNEFACP
QWKSGDWSECLVTCGKGHKHRQVWCHFGEDRLNDRMCDAAAKPVSMQTCQQPECASWQAG
SWGQCSVTCGQGYQRRAVKCILGAYMSVVDDNDCNAATRPTDTQDCELPSCHPLPLAPEA
RRSSHGVPRTQWRFGSWTPCSATCGKGTRMRYVSCRDEDGSVADENACAMLPRPVAKEEC
AVTPCGQWKALDWSSCSVTCGQGRATRQVVCVNYSDHVVDQSECDPDYIPETDQDCSMSP
CLQWTPDSLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVC
QDENGYTANDCVERIKPDEQRACESGPCPQWIYGSWGECTKLCGGGMRTRLVVCQRSNGE
RFPDLSCDILEKPPDHEQCNTHACRQDAAWSTGPWSSCSVSCGRGHKQRNVYCLAKDGSH
LESDYCKHLAKPHGHRKCRGGRCPKWKAGAWSQCSVSCGQGVQHRQVDCHIGAHKTARET
ECNPYTRPESERICQVTPCPLYAWRTEQWQECTKTCGEGTRYRRVRCVAEDQGEVHAAHC
DASQRPADGESCSSQPCEYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQT
TMNCPGTQPPSVHPCYLRDCPVSATWRVGNWGSCSVSCGVRVMHRSVQCLTNEDQPSHLC
LTDLKPDEQKTCHNVYNCELPQTCKEVKRLNGVREDGEYFLTVRGKLLKVFCAGMQSDRP
KEYVTLVHGDSENFSEVYGHRLHNPTECPYNGSRRDDCQCRKDYTAAGFSSFQKIRIDLS
SMQII
Download sequence
Identical sequences ENSDORP00000001175 ENSDORP00000001175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]