SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001199 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001199
Domain Number 1 Region: 62-121,151-207
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000142
Family Reprolysin-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001199   Gene: ENSDORG00000001281   Transcript: ENSDORT00000001280
Sequence length 262
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_12142:26971:32325:-1 gene:ENSDORG00000001281 transcript:ENSDORT00000001280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLANTRVISEEYIKWLKSYCEAFFYGLTVKLLEPVSVSATKCSFRVNDHTQNLQIHAGHI
LTFLKKKKREDAFCVVGITMIDLYPRDSWNFVFGQASLTDGVGIFSFARYGKDFYSSHYK
GKVKKPKRVSSSDYSXXXXXXXXXXXXXXXXXXXXTLTHEIGHIFGLRHCQWLACLMQGS
NHLEEADRRPLNLCPICLRKLQCALGFNIVERYKALVRWIDEECTDTPAPKPSCENAVSV
PKPVEAFKEWREWVVKCLAVLQ
Download sequence
Identical sequences ENSDORP00000001199 ENSDORP00000001199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]