SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001221 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001221
Domain Number 1 Region: 110-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-35
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001221   Gene: ENSDORG00000001304   Transcript: ENSDORT00000001303
Sequence length 224
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_78:116039:131838:-1 gene:ENSDORG00000001304 transcript:ENSDORT00000001303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPTIQGFLLLFLFGYKXXXXXXXXXDEGEGPWDQKPCKCDCQGGANGLWSAGAISLDCI
PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCAWLSKFQDSN
QWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNS
DRSSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA
Download sequence
Identical sequences ENSDORP00000001221 ENSDORP00000001221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]