SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001240 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001240
Domain Number 1 Region: 2-233
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.79e-69
Family Eukaryotic proteases 0.00063
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001240
Domain Number - Region: 257-328
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0377
Family Spermadhesin, CUB domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001240   Gene: ENSDORG00000001329   Transcript: ENSDORT00000001327
Sequence length 371
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_26016:7809:19109:-1 gene:ENSDORG00000001329 transcript:ENSDORT00000001327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLKQRHKHICGGTIISPQWVVTAAHCIAHRSIASALNVTAGEYDLSQTDPGEQTLAIAT
AIIHPQFSIRKPMDYDIALLKMAGTFQFGQFVGPMCLPEPGEKFKAGFTCTTTGWGRLTE
GGNFPQVLHEVNLTILPQKECTAALLTLQKPITGNTFLCTGSPDGGRDACQGDSGGSLVC
PNKKGTWTLVGVTSWGLGCGRNWRNNRQKKRQGSPGIFTDLRKVLPWVYENVPEYQRVYS
LQDELVIGGGGAGHLHNKCVWTLVQEDSHIWLCFAHLVAKPGHHDSLPMYVQDRLVGKLG
KGSNSIRLKFSSNAADYATEFNLTHKALKSNYLPDSGCSSFTGLFEEGIRKPHSDMASYN
IFQAPRHYLIR
Download sequence
Identical sequences ENSDORP00000001240 ENSDORP00000001240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]