SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001243 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000001243
Domain Number - Region: 135-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000329
Family Spermadhesin, CUB domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001243   Gene: ENSDORG00000001330   Transcript: ENSDORT00000001330
Sequence length 739
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4688:4116:14027:-1 gene:ENSDORG00000001330 transcript:ENSDORT00000001330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CMSGLCPLGEVRLQPPTSELPRLNRTFIWDVKAHKSVGLELQFPLPRLRQIAPGEKCQDG
TSYSISGRIDATVVQIGTFCSNGTVSRIKTQEGVKVALHLPWFLSRNTSGFNITNRSSSI
KXXXXXXXVFEGEGSATLMSANYPEAFPEDELMTWQFVIPAHLRASVSFLNFSVSNCERK
EERVEYYIPGSTTNPEVFKLGDKQPGNMAGNFNLSLQGCDQDAQSPGILRLQFQVLVQHP
QNESNKTYVIDLSQERSMSLTIEPRHLKHGRKFVPGCFVCLESRTCSTNVTLTAGSKHTI
SFLCDDLTRLWVNAEKTISCLDPRYCYKRSYSLRVPGYILQLPVELRDFSWKLLVPKDQL
SLVIVPAQKLQQHTQERVCNTSYSYLVGSSTGGHDFGYFCLGGSIERILVKENSSVTLRT
FTSSFLQDVSRQSLTVSFIPNLKEEGIFTVTPDTTSKVYLRTPNWDRGMPALSSVSWNIS
VPREQEAYLTFYRERSGVVCQSGRAYMIIQEQQSQAEEIFSLEDDILPKPRCYHHSFWVN
ISNCSPASSKQLNLLFWVTLTPRTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKQLN
KGPVVGIYNGHINTQMPRQPRKFPKGRADNDSHVYAVIDDCMVYGHLLQEGSNGSFLRPE
VDTYRPFQGPMGDCPPSPPPIGSRAPTTKLSNDEALPCAPPESESEPYTFSHPHPHDGSQ
RDTDIPLLETQQPEKPAAE
Download sequence
Identical sequences ENSDORP00000001243 ENSDORP00000001243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]