SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001244 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001244
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.21e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001244   Gene: ENSDORG00000001332   Transcript: ENSDORT00000001331
Sequence length 111
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6777:1041:2396:1 gene:ENSDORG00000001332 transcript:ENSDORT00000001331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIYKSVTINTSKEMMCFSDFPIPDHFPNYMHNTKLMDYFRMYAKHFGLLNYICFKTKV
CSVRKRPDFSNSGQWDVVVEMNEKQETLVFDGILVCSGHHTDPYLPLHSFP
Download sequence
Identical sequences ENSDORP00000001244 ENSDORP00000001244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]