SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001250 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001250
Domain Number 1 Region: 681-775
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-22
Family MAM domain 0.0022
Further Details:      
 
Domain Number 2 Region: 167-256
Classification Level Classification E-value
Superfamily Immunoglobulin 8.11e-17
Family I set domains 0.0051
Further Details:      
 
Domain Number 3 Region: 475-562
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000678
Family I set domains 0.035
Further Details:      
 
Domain Number 4 Region: 81-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000045
Family I set domains 0.079
Further Details:      
 
Domain Number 5 Region: 580-678
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000698
Family Fibronectin type III 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001250
Domain Number - Region: 17-60
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000117
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001250   Gene: ENSDORG00000001338   Transcript: ENSDORT00000001339
Sequence length 776
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1783:295:11256:-1 gene:ENSDORG00000001338 transcript:ENSDORT00000001339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRWTKTAGSASDKFQETSVFNETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYL
DEPVLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQDNGVDIYEP
LYTQGEIKVLKLKNVRPQDYASYTQVSVRNVCGIPDRAVFRLTNATAPPALKLSVNETLV
VNPGENVTVQCLLTGGDPLPQLQWSHGPGPLPLGALAQGGTLSIPSVQARDSGYYNCTAT
NNVGNPAKKTVNLLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSQDVR
QALSRPVLLRCSLLRGSPQRIASVAWRFKGQLLPPPPVVPAATEAADHAELRLDALTRDS
SGSYECSLSNDVGSATCLFQVSAKAYSPEFYFDTPNPTRSHKLSKNYSYVLQWTQREPDA
VDPVLNYRLSVRQLNQHNAMVKAIPVRRVEKGQLLEFILTDLRVPHSYEIRLTPYTTFGA
GDTASRTIHYTEPINSPSLSDNTCHFEDEKICGYTQDLTDNFDWTRQNALTQNPKRSPNT
GPPTDISGTPEGYYMFIETSRPRELGDRARLVSPLYNASAKFYCVSFFYHMYGKHI
Download sequence
Identical sequences ENSDORP00000001250 ENSDORP00000001250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]