SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001254 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001254
Domain Number 1 Region: 30-57,174-309,405-473
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000022
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001254
Domain Number - Region: 300-425
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0268
Family Alcohol dehydrogenase-like, C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001254   Gene: ENSDORG00000001345   Transcript: ENSDORT00000001343
Sequence length 490
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3396:5297:13309:1 gene:ENSDORG00000001345 transcript:ENSDORT00000001343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWRRSQQLPGPTMSAQRKGHLGTSSSAPLPVIIIGNGPSGICLSYLLSGHTPYARPDAVH
PHPLLQRKLTEAPGVSILDQDLEYLSEGLEGRSQSPVALLFDALLRPDTDFGGNADSVLT
WRLQKERAVPHLVLGRNPPGGAWHSIEGSMVTLSQGQWMGLPDLDVKDWILKKRRGLRNS
RATAGDMAHYYQDYVTRKGLGPRFVSGAEVTAVEWEGSEPGSPAAPAPGPLFRVSGFLAA
EDRPRRPFALWAHNVVLATGTFDSPARLAIPGEALPFVHHELSALEAAVRAGAVTPASDP
ILVVGAGLSAADAVLYARHYNIPVIHAFRRPVEDPGLVFNQLPRMLYPEYHKVHQMMREQ
SILSPSPYQGYRSLPEHRPLLFKEGGQAVFRDPRGGQQVFSTSLVLVLIGSHPDLSFLPG
AGADLTVDPTQPPSAKRNPIDVDPYTYQSAQQEGLYALGPLAGDNFVRFVQGGALAAASS
LLRKAPRKPP
Download sequence
Identical sequences ENSDORP00000001254 ENSDORP00000001254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]