SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001266 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001266
Domain Number 1 Region: 137-184
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.99e-16
Family LIM domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001266   Gene: ENSDORG00000001362   Transcript: ENSDORT00000001356
Sequence length 193
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5893:27479:31453:1 gene:ENSDORG00000001362 transcript:ENSDORT00000001356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKVSSLGKDWHKFCLKCERCNKTLTPGGHAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XEKVTSLGKDWHRPCLRCERCSKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGS
YIYDRDPEGTVQP
Download sequence
Identical sequences ENSDORP00000001266 ENSDORP00000001266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]