SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001319 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001319
Domain Number 1 Region: 289-485
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.92e-69
Family Hemopexin-like domain 0.00000746
Further Details:      
 
Domain Number 2 Region: 79-243
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.98e-51
Family Matrix metalloproteases, catalytic domain 0.000000123
Further Details:      
 
Domain Number 3 Region: 1-62
Classification Level Classification E-value
Superfamily PGBD-like 1.33e-18
Family MMP N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001319   Gene: ENSDORG00000001419   Transcript: ENSDORT00000001415
Sequence length 561
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2473:7751:32156:1 gene:ENSDORG00000001419 transcript:ENSDORT00000001415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NWLKSYGYLLPYDSRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVP
DHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVQVTPLTFE
EVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPW
TLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQK
IYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPSTPGTKPNICDGNF
NTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERSDGRFVFFK
GDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERR
ATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILR
DWMGCNQKEVERRKERRLPQDDVGIMVTINDVPGSVNAVAVVIPCILSLCILVLVYTIFQ
FKNKAGPQPVTYYKRPVQEWV
Download sequence
Identical sequences ENSDORP00000001319 ENSDORP00000001319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]