SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001351 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001351
Domain Number 1 Region: 92-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.2e-28
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001351   Gene: ENSDORG00000001449   Transcript: ENSDORT00000001448
Sequence length 237
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_37091:2888:5464:-1 gene:ENSDORG00000001449 transcript:ENSDORT00000001448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTTPADHLPTQQSPEQGHPEVPGDEADDGSDTVVLSLFPCTPEPGNPEADASASSLQA
GSSLKHSTTLTNRQRGNEVSALPATLDSLSVHQLAAQGELSQLKEHLRKGDNLVNKPDER
GFTPLIWASAFGEIETVRFLLEWGGYTDIVALLLDCDVDINIFDWNGGTPLLYAVRGNHV
KCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSSLRPDDPE
Download sequence
Identical sequences ENSDORP00000001351 ENSDORP00000001351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]