SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001355 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001355
Domain Number 1 Region: 70-186
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.26e-26
Family Ankyrin repeat 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001355   Gene: ENSDORG00000001451   Transcript: ENSDORT00000001452
Sequence length 273
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_856:4:31392:-1 gene:ENSDORG00000001451 transcript:ENSDORT00000001452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMAAAAGAGVEAGFSNEELMSLRFPLHSTWRDGXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLECLIQLVRAGATLNTSTTRYAQTPAHIAAFGGHPQCLVWLIQAGANINK
PDCEGETPIHKAARSGSLECISTLVANGAQADLRNASGLTAADIAQTQGFRECTQFLLSL
RNHHLSRFYHNGTLTGSHENVFPDCVSAGTNRKRCLEDVASSGVKKARTGAPTLDYVMPL
VNGELEDDADKMHIDRELATETDMRNSSSTSNT
Download sequence
Identical sequences ENSDORP00000001355 ENSDORP00000001355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]