SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001361 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001361
Domain Number 1 Region: 207-401
Classification Level Classification E-value
Superfamily MIR domain 2.62e-64
Family MIR domain 0.0000000933
Further Details:      
 
Domain Number 2 Region: 403-539
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 7.85e-40
Family IP3 receptor type 1 binding core, domain 2 0.00000225
Further Details:      
 
Domain Number 3 Region: 1086-1238
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.03e-31
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 79-145
Classification Level Classification E-value
Superfamily MIR domain 0.000000000157
Family MIR domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001361
Domain Number - Region: 1222-1298,1376-1645,1835-1945
Classification Level Classification E-value
Superfamily ARM repeat 0.00121
Family Armadillo repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001361   Gene: ENSDORG00000001447   Transcript: ENSDORT00000001458
Sequence length 2616
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_990:11611:58428:1 gene:ENSDORG00000001447 transcript:ENSDORT00000001458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVDDRCVVEPAAGDLDNPPKKFRDCLFKVCPMNRYSAQKQYWKAKQTKQDKEKIADVVLL
QKLQHAAQMEQKQNDTENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRV
TLDATGNEGSWLFIQPFWKLRSNGDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCKEV
NSVNCNTSWKINLFMQFRDHLEEVLKGGDVVRLFHAEQEKFLTCDEYKGKLQVFLRTTLR
QSATSATSSNALWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEENPSYKGDASDP
KAAGIGRTGRRNAGEKIKYRLVAVPHGSDIASLFELDPTTLQKTDSFVPRNSYVRLRHLC
TNTWIQSTNVPIDIEEERPIRLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLA
SAVEKLNEGFISQNDRRFVIQLLEDLVFFVSDVPNNGQNVLDIMVTKPNRERQKLMREQN
ILKQIFGILKAPFRDKGGEGPLVRLEELSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLDY
LSDLCVSNHVAIPVTQELICKCVLDPKNSDILIQTELRPLKEMAQSHEYLSIEYSEEEVW
LTWTDKNNEHHEKSVRQLAQEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLAIDEISQ
QLGVDLIFLCMADEMLPFDLRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIPTAITIK
DYDSNLNTSRDDKKNKFASTMEFVEDYLSNVVGEAVPFANEEKNKLTYEVVSLAHNLIYF
GFYSFSELLRLTRTLLGIIDCVQGPPAMLQVFEDPGGKNVRRSIQGVGHMMSTMVLSRKQ
SVFGAPSLPAGAGAAEPLDRSKFEDNEDIVVMETKLKILEILQFILNVRLDYRISYLLSV
FKKEFVEVFPMQDSGADGTAPAFDSTTANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGR
MFLRVLIHLTMHDYAPLVSGALQLLFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSE
LDRLRTMVEKSELWVDKKGSGKGEEGEAGTAKDKKERPTDEEGFLQPSGEKSSENYQIVK
GILERLNKMCGVGEQMRKKQQRLLKNMDAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQ
KFCAGNPGNQALLHKHLHLFLTPGLLEAESMQHIFLNNYQLCSEISEPVLQHFVHLLATH
GRHVQYLDFLHTVIKAEGKYVKKCQDMIMTELTNAGEDVVVFYNDKASLAHLLDMMKAAR
DGVEEHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVTVVTHEDCITEVKMAY
VNFVNHCYVDTEVEMKEIYTSNHIWTLFENFTLDMARVCNKREKRLADPTLEKYVLTVVL
DTISAFFSSPFSENSTSLQTHQTIVVQLLQSTTRLLECPWLQQQHKSSVEACVRTLAMVA
KGRSISLPMDLDAHISVLLSSGSSSAAAAQRNAASYKTATRTFPRLTPTANQWDYKNIIE
KLQDIITALEERLKPLVQAELSVLVDVLHWPELLFLEGSEAYQRCESGGFLCKLIQHTKD
LMESEEKLCIKVLRTLQQMLLKKTKYGDRGNQLRKMLLQNYLQNRKSSSRGDLPDPMGTG
LDQDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFY
NLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDREPADPTTKGRLASF
SIPGSSSRYSLGPSLHRGHEVGERVQSNEMGTSVLIMQPILRFLQLLCENHNRDLQNFLR
CQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINEDNVGLVIQTLETLTEYCQGPCH
ENQTCIVTHESNGIDIITALILNDISPLCKYRMDLVLQLKDNASKLLLALMESRHDSENA
ERILISLRPQELVDVIKKAYLQEEERENSEVSPREVGHNIYILALQLSRHNKQLQHLLKP
VKRIQEEEAEGISSMLSLNNKQLSQMLKSSVPAQEEEEDPLAYYENHTSQIEIVRQDRSM
EQIVFPVPGICQFLTEETKHRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPL
IYWFSRRMTLWGSISFNLAVFINIIIAFFYPYVEGASTGVLGSPLISLLFWILICFSIAA
LFTKRYSIRPLIVALILRSIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKA
MVMDMEFLYHVGYILTSVLGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTA
LLALILVYLFSIVGFLFLKDDFILEVDRLPGNHSRASPLGVPHGAATFVGTCSGDKMECA
SGVAVPEVLEEDEELDSTERACDTLLMCIVTVMNHGLRNGGGVGDILRKPSKDESLFPAR
VVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTV
SFEEHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSN
EGEGEQNEIRILQDKLSSTMKLVSHLTAQLNELKEQ
Download sequence
Identical sequences ENSDORP00000001361 ENSDORP00000001361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]