SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001382 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001382
Domain Number 1 Region: 205-400
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.27e-68
Family Reprolysin-like 0.0000116
Further Details:      
 
Domain Number 2 Region: 419-493
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 3.01e-19
Family Blood coagulation inhibitor (disintegrin) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001382   Gene: ENSDORG00000001473   Transcript: ENSDORT00000001481
Sequence length 767
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_253:52165:89288:1 gene:ENSDORG00000001473 transcript:ENSDORT00000001481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPGSLVLLTFLLAPVPVRGTKELPKAKKYEVVYPVRLHPLHKRELAEPKNQAPSETEVT
YEVKVNGKVTMLYLKKNKNLLAPGYTETHYNSNGEMVTTSPQIMDNCYYQGHVINAETSD
ASISTCEGLRGYFSQGGERYFIEPLSHRNQDDQEHALFKEDPEEDVVNATCGLGDVLRAH
QSHHSVDLPATRVIKMHGGKNQEQKKYIEYYVVLDNGEFKKYGKNLDEIRKRIFEMANYI
DMLYRKLNATVVLVGLEIWTDEDKIKITPNATSTLDNFSKWRGRNLLSRKRHDVAQLVSS
EDFSGATVGLAFLSSMCSPYHSVGIVQDHSSNHLRVAGTMAHEMGHNLGMFHDDLSCKCL
SAVCVMEKSMRFYMPTDFSSCSRANYYKFLEDKSSHCLLNTPLPTDIISVPVCGNQLVEM
GEDCDCGTPEECTNRCCDARTCRIKAGLRCASGECCERCQFKKAGAVCRAAEHECDLPEM
CDGKSSDCAEDRFRVNGFHCGNGRGYCLMGRCPTLEQQCKEMWGPETKVAEKSCYHRNED
GSQYGYCHIVNGTPVPCEAKDVMCGKLFCEGGSGNLPWKGFTVTFKGCKLFDPEDPSQGL
DMVANGTKCGNNKVCVSARCVDVERAYNSANCSSKCQGHAVCDHKLQCQCKGGWAPPDCR
DSAAIFHFSIVVGVLFPMAVILVVVTILIWHQSTRRKQKVQRPLSTTNTRPHKQKAKPQM
LKAVQPQEXXXXXXXXXXXXXXXXXXXXXXDAKASLSTVFKGSSPKV
Download sequence
Identical sequences ENSDORP00000001382 ENSDORP00000001382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]