SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001392 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001392
Domain Number 1 Region: 27-196
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.93e-46
Family Dual specificity phosphatase-like 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001392   Gene: ENSDORG00000001490   Transcript: ENSDORT00000001492
Sequence length 212
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_6458:20288:38752:1 gene:ENSDORG00000001490 transcript:ENSDORT00000001492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPISIQASEFDSSDEEPGEDEQTPIQISWLPLSQINCSQFLGLCALPGCKFKDVRRNV
HKDTEELRSYGIQDIFVFCTRGELSKYRVPNLLDLYQQYGIITHHHPIPDGGTPDIDRCW
EIMEELAICLKNNRKTLIHCYGGLGRSCLVAACLLLYLSDTVSPQQAIDSLRDVRGSGAI
QTIKQYNYLHEFRDKLASYLSTRESLSRSVSR
Download sequence
Identical sequences ENSDORP00000001392 ENSDORP00000001392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]